PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.8G028700.1.p
Common NamePRUPE_ppa002848mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family Trihelix
Protein Properties Length: 631aa    MW: 70569.9 Da    PI: 6.4843
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.8G028700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix92.34.8e-2962146187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW++qe+laL+++r++m+ ++r+++ k+plW+evs+k+++ g++rs+k+Ckek+en+ k+++++keg+ ++++++  t+++fdqlea
  Prupe.8G028700.1.p  62 RWPRQETLALLQIRSDMDVAFRDASVKGPLWDEVSRKLAALGYHRSAKKCKEKFENVYKYHRRTKEGRTGKSEGK--TYRFFDQLEA 146
                         8********************************************************************975544..6*******85 PP

2trihelix104.76.6e-33430514186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         rW+k ev+aLi++r++++++++++  k+plWee+s +mr+ g++rs+k+Ckekwen+nk++kk+ke++k+r +e+s+tcpyf+ql+
  Prupe.8G028700.1.p 430 RWPKVEVQALIKLRTSLDSKYQENGPKGPLWEEISGAMRKLGYNRSSKRCKEKWENINKYFKKVKESNKRR-PEDSKTCPYFHQLD 514
                         8********************************************************************97.99**********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007176.3E-459121IPR001005SANT/Myb domain
PROSITE profilePS500906.84161119IPR017877Myb-like domain
PfamPF138377.3E-1961147No hitNo description
CDDcd122036.25E-2361126No hitNo description
Gene3DG3DSA:1.10.10.604.2E-4420486IPR009057Homeodomain-like
PROSITE profilePS500907.503423487IPR017877Myb-like domain
SMARTSM007170.001427489IPR001005SANT/Myb domain
PfamPF138372.1E-22429516No hitNo description
CDDcd122031.84E-28429494No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010192Biological Processmucilage biosynthetic process
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 631 aa     Download sequence    Send to blast
MLGDSSVLGS AISRDATTTA AVAVPEGGGG GGGSNSGEDT FRGGGGGDDL LGSGERSFGG  60
NRWPRQETLA LLQIRSDMDV AFRDASVKGP LWDEVSRKLA ALGYHRSAKK CKEKFENVYK  120
YHRRTKEGRT GKSEGKTYRF FDQLEALENQ PQTPGTTHHH QAKPHHQSTM AAAAATMATM  180
ASTIPSSAAP HPIISNVSSQ AIAAPTLNLA APNSFPPTNP IVLPPPPPTT TNPTNNPHHH  240
HHNTFSSSFP NISADLSTSS STSSDEDLEG RAKRKRKWKD FFQRLMKEVI QKQEDLQKRF  300
LEAIEKREHE KMVREEAWRM QEMARVNRER EILAQERSIA AAKDAAVMSF LQKISEQQQN  360
PNQTPPPGQS QINNNLLQLQ PPPLVPPPPR QPAPQPQPQP QQPVTNFDLV TKPNNNGENN  420
NLSSPASSSR WPKVEVQALI KLRTSLDSKY QENGPKGPLW EEISGAMRKL GYNRSSKRCK  480
EKWENINKYF KKVKESNKRR PEDSKTCPYF HQLDSLYRER NKFDHNNVNP KPENSVPLMV  540
RPEQQWPPPT PQQQQQQDHQ NMDIVHHHHD HQNQEDDHHD HQDKENIIGG DEDEEEEDDD  600
DEEDEEEDEG DGNYEIVANK PAPVGAAAAE *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4334765e-37AM433476.2 Vitis vinifera contig VV78X257449.9, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007201190.10.0hypothetical protein PRUPE_ppa002848mg
SwissprotQ391171e-145TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLM5VMH50.0M5VMH5_PRUPE; Uncharacterized protein
STRINGPOPTR_0002s06920.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.18e-95Trihelix family protein